DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and rap1aa

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001002152.1 Gene:rap1aa / 415242 ZFINID:ZDB-GENE-040625-167 Length:185 Species:Danio rerio


Alignment Length:185 Identity:105/185 - (56%)
Similarity:137/185 - (74%) Gaps:4/185 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFA 65
            |||:|:||||||||||||||||||.|.|:|||||||||.|||::|||...|:||||||||||||.
Zfish     1 MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65

  Fly    66 SMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAE 130
            :|||||:|||.||.::||:|...||.|:..::..|.|||.::..|::||.||.||:.:|.|...:
Zfish    66 AMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEEERVVGKEQ 130

  Fly   131 GNALAQLW-DCPFIEASAKDRINVNEVFATIVREMNL---TQENRQKKNYCCCTL 181
            |..||:.| :|.|:|:|||.:|||||:|..:||::|.   .::.|.||...|..|
Zfish   131 GQNLARQWSNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKRAKKKSNCVLL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 86/149 (58%)
rap1aaNP_001002152.1 small_GTPase 2..168 CDD:197466 99/165 (60%)
Rap1 3..167 CDD:133375 97/163 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1353024at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X266
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.