DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and zgc:55558

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_956552.1 Gene:zgc:55558 / 393228 ZFINID:ZDB-GENE-040426-740 Length:187 Species:Danio rerio


Alignment Length:188 Identity:84/188 - (44%)
Similarity:127/188 - (67%) Gaps:7/188 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFA 65
            |.|:|:||:|:|||||||||:|.:...|:::|||||||.|||::.:|...|:|:||||||.|:::
Zfish     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65

  Fly    66 SMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAE 130
            :|||.|::.|.||:.::::.|.::|:|:...:..|.|||.|...|::||.||.|| ..|.|.|.:
Zfish    66 AMRDQYMRTGEGFLCVFAINNAKSFEDVHLYREQINRVKDSDNVPMVLVGNKSDL-TSRTVDTRQ 129

  Fly   131 GNALAQLWDCPFIEASAKDRINVNEVFATIVREMNLTQE----NRQKKNYC--CCTLL 182
            ...||:.:..||:|.|||.|..|.|.|.::|||:...:|    |::.|.:.  .||||
Zfish   130 AQELARSYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSNKKSKKHTQRRCTLL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 67/148 (45%)
zgc:55558NP_956552.1 H_N_K_Ras_like 3..164 CDD:133338 76/161 (47%)
RAS 16..166 CDD:214541 67/150 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.