DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and CG8641

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster


Alignment Length:180 Identity:55/180 - (30%)
Similarity:94/180 - (52%) Gaps:14/180 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFASMR 68
            :::|:|||...|||::..:|:...|.|.|.||||:|:||...:.:....|:||||:|...|.:||
  Fly   167 YRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYHPFPAMR 231

  Fly    69 DLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVK------GS-------QPAPILLVANKFDL 120
            .|....|..||:::|:.:.::|:::..::..|...|      ||       ...|::|..||.|.
  Fly   232 RLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNKCDR 296

  Fly   121 DCQR-EVSTAEGNALAQLWDCPFIEASAKDRINVNEVFATIVREMNLTQE 169
            |.:. :|....|....|...|.|:|.||:....::::|.::....||..|
  Fly   297 DFKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLPLE 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 47/162 (29%)
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 55/180 (31%)
RAS 167..338 CDD:214541 52/170 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453057
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.