DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and Diras3

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_345726.2 Gene:Diras3 / 366733 RGDID:1565168 Length:200 Species:Rattus norvegicus


Alignment Length:163 Identity:74/163 - (45%)
Similarity:117/163 - (71%) Gaps:0/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 REFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFAS 66
            ::::||:|||..|||:||..||..|.|.|:.:|::|:.:.|.|||:.:|.:|||:||.|.|...:
  Rat    10 KDYRVVLLGSVAVGKTALATQFACGRFPERCEPSVEELFSKVIEVNRAPALLEIVDTVGAEHLVT 74

  Fly    67 MRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAEG 131
            ::||||:|..||:|:||:.|..:||.:..::..:.|::||:..|::||..|.|||.:|:|.||:|
  Rat    75 LKDLYIRNSDGFVVLYSVCNEASFQAVRPLRERMGRLRGSRAVPLVLVGTKVDLDAERQVLTAQG 139

  Fly   132 NALAQLWDCPFIEASAKDRINVNEVFATIVREM 164
            .|||:.|.|||:|.:||.::.|:.||..:||||
  Rat   140 RALAREWRCPFLEITAKSKMMVDRVFTQVVREM 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 67/149 (45%)
Diras3XP_345726.2 small_GTPase 10..173 CDD:197466 74/163 (45%)
P-loop_NTPase 11..172 CDD:304359 72/160 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48239
OrthoDB 1 1.010 - - D1353024at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.