DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and kappaB-Ras

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster


Alignment Length:197 Identity:51/197 - (25%)
Similarity:89/197 - (45%) Gaps:37/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVVVLGSGGVGKSALTVQFVSGCFIEKYD--PTIEDFYRKEIEVDSSPC--VLEILDTAGTEQFA 65
            ||:|.|..||||:||..|.|.|....:.:  |||||.|...::......  .|.|.||||.:  .
  Fly    11 KVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASVDTGRGGARETLRIYDTAGLQ--G 73

  Fly    66 SMRDL---YIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVAN----------- 116
            ..:.|   |::....|:::|...:.::...::.:|..|.:.|..:..|::::||           
  Fly    74 EQQQLPRHYLQFPDAFVLVYDPMDPRSLDMLADIKADIEKHKEKKEIPVVVLANVRARAAPNPVE 138

  Fly   117 ----KFDLDCQRE------VSTAEGNALAQLWDCPFIEASAKDRINVNEVFATIVREMNLTQENR 171
                :.::.||||      |:..|..:|.:    ||....|  |::..:..:|. .::....:||
  Fly   139 KVMDRANIWCQRERIKHYTVNAMERPSLYE----PFTTLCA--RLHPMQTKSTF-PQLRQVMQNR 196

  Fly   172 QK 173
            ||
  Fly   197 QK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 40/176 (23%)
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 44/167 (26%)
Ras_like_GTPase 13..174 CDD:206648 42/166 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.