DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and CG13375

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster


Alignment Length:168 Identity:57/168 - (33%)
Similarity:99/168 - (58%) Gaps:5/168 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFASMRD 69
            |:||:||..|||:::..||:...|..||..|||:.::....:......|:||||||:.:|.:||.
  Fly    49 KIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYEFPAMRA 113

  Fly    70 LYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDL----DCQREVSTAE 130
            |.|.:...||::|.:|:..||:::.::::.|...|.:...||::|.||.||    :.:|||..|.
  Fly   114 LSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGNKIDLLADGETEREVEYAT 178

  Fly   131 GNALAQL-WDCPFIEASAKDRINVNEVFATIVREMNLT 167
            ..::..: |:..|:||||....|:.:||..::.:..:|
  Fly   179 TESVVTVDWENGFVEASASSNENITQVFKELLAQAKIT 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 49/153 (32%)
CG13375NP_001162628.1 RAS 48..215 CDD:214541 56/165 (34%)
Ras_dva 49..239 CDD:206714 57/168 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453075
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.