DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and Hras

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_006230597.3 Gene:Hras / 293621 RGDID:2827 Length:290 Species:Rattus norvegicus


Alignment Length:191 Identity:83/191 - (43%)
Similarity:123/191 - (64%) Gaps:13/191 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFA 65
            |.|:|:||:|:|||||||||:|.:...|:::|||||||.|||::.:|...|:|:||||||.|:::
  Rat   102 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 166

  Fly    66 SMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAE 130
            :|||.|::.|.||:.::::.|.::|:||...:..|.|||.|...|::||.||.|| ..|.|.:.:
  Rat   167 AMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL-AARTVESRQ 230

  Fly   131 GNALAQLWDCPFIEASAKDRINVNEVFATIVREMNLTQENRQKKN----------YCCCTL 181
            ...||:.:..|:||.|||.|..|.:.|.|:|||  :.|...:|.|          .|.|.|
  Rat   231 AQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE--IRQHKLRKLNPPDESGPGCMSCKCVL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 67/148 (45%)
HrasXP_006230597.3 H_N_K_Ras_like 104..265 CDD:133338 76/163 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.