DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and rhb1

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_595194.1 Gene:rhb1 / 2540853 PomBaseID:SPBC428.16c Length:185 Species:Schizosaccharomyces pombe


Alignment Length:160 Identity:62/160 - (38%)
Similarity:98/160 - (61%) Gaps:0/160 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFASMRD 69
            ::.||||..||||:||||:|...|:|.|.||||:.:.|.|:........||:||||.::::.:..
pombe     8 RIAVLGSRSVGKSSLTVQYVENHFVESYYPTIENTFSKNIKYKGQEFATEIIDTAGQDEYSILNS 72

  Fly    70 LYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAEGNAL 134
            .:....||::::||:|:..:|:.:..:::.|....|::..||::|.||.||..||.|:..||.||
pombe    73 KHSIGIHGYVLVYSITSKSSFEMVKIVRDKILNHTGTEWVPIVVVGNKSDLHMQRAVTAEEGKAL 137

  Fly   135 AQLWDCPFIEASAKDRINVNEVFATIVREM 164
            |..|.|.:.||||:...||...|..|:.|:
pombe   138 ANEWKCAWTEASARHNENVARAFELIISEI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 56/149 (38%)
rhb1NP_595194.1 small_GTPase 5..170 CDD:197466 62/160 (39%)
RheB 6..184 CDD:206709 62/160 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.