DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and Rras

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_033127.1 Gene:Rras / 20130 MGIID:98179 Length:218 Species:Mus musculus


Alignment Length:188 Identity:81/188 - (43%)
Similarity:117/188 - (62%) Gaps:10/188 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFASMRD 69
            |:||:|.|||||||||:||:...|:..|||||||.|.|...||..|..|:||||||.|:|.:||:
Mouse    31 KLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGIPARLDILDTAGQEEFGAMRE 95

  Fly    70 LYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAEGNAL 134
            .|::.|:||::::::.:.|:|.::..:...|.|||.....||:||.||.||:.||:|..:|.::.
Mouse    96 QYMRAGNGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPIVLVGNKADLENQRQVLRSEASSF 160

  Fly   135 AQLWDCPFIEASAKDRINVNEVFATIVREMNLTQEN----------RQKKNYCCCTLL 182
            :......:.|||||.|:||:|.|..:||.:...||.          |:|...|.|.||
Mouse   161 SASHHMTYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKDGGCPCVLL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 65/148 (44%)
RrasNP_033127.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
M_R_Ras_like 28..191 CDD:133345 73/159 (46%)
Effector region 58..66 7/7 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.