DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and rap-3

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_502095.2 Gene:rap-3 / 182417 WormBaseID:WBGene00004309 Length:205 Species:Caenorhabditis elegans


Alignment Length:200 Identity:83/200 - (41%)
Similarity:120/200 - (60%) Gaps:19/200 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFA 65
            |:|:|:||||:|||||||||:|:|.|.|:..||.||||.|||..:||:....||||||||||||.
 Worm     1 MKEYKIVVLGNGGVGKSALTLQYVQGIFVHTYDATIEDSYRKLSKVDAENARLEILDTAGTEQFT 65

  Fly    66 SMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAE 130
            .||:.|.:...||::::||....||:::......|..::|.: .|::||.||.||...|:|..:|
 Worm    66 GMRETYYRTAQGFVLVFSLAETSTFENLKQTFTDIIAIRGKE-VPMILVGNKSDLAETRQVDESE 129

  Fly   131 GNALAQLWDCPFIEASAKDRINVNEVF---ATIVREMNLTQENRQK------------KNY---C 177
            .:..|:....|:.|.||:...||:|||   |.::::.......|:|            ||:   |
 Worm   130 AHNFAEKLKIPYFETSARLNQNVSEVFEECAVLIQKSAKPNIERRKWSSESEIGDKKCKNWLRSC 194

  Fly   178 CCTLL 182
            ||.|:
 Worm   195 CCCLI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 64/151 (42%)
rap-3NP_502095.2 small_GTPase 2..166 CDD:197466 74/164 (45%)
Ras 5..158 CDD:206642 72/153 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1353024at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.