DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and rap-1

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_501549.1 Gene:rap-1 / 177709 WormBaseID:WBGene00004307 Length:188 Species:Caenorhabditis elegans


Alignment Length:188 Identity:101/188 - (53%)
Similarity:136/188 - (72%) Gaps:6/188 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFA 65
            |||:|:||||||||||||||||||.|.|:|||||||||.|||::|||...|:||||||||||||.
 Worm     1 MREYKIVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65

  Fly    66 SMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAE 130
            :|||||:|||.||:::||:|...||.|:..:::.|.|||.:...|::||.||.||:.:|.|...:
 Worm    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLMDLRDQILRVKDTDEVPMILVGNKCDLEDERVVGKDQ 130

  Fly   131 GNALAQLWDCPFIEASAKDRINVNEVFATIVREMNL------TQENRQKKNYCCCTLL 182
            |..||:.:...|:|.|||.:|||:|||..:||::|.      .::.:..|..|.|.::
 Worm   131 GQNLARQFGSAFLETSAKAKINVSEVFYDLVRQINRRYPESGRRQGQSNKQCCSCVIM 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 84/148 (57%)
rap-1NP_501549.1 Rap1 3..166 CDD:133375 95/162 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1353024at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X266
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.