DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and rheb-1

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_499079.1 Gene:rheb-1 / 176327 WormBaseID:WBGene00010038 Length:207 Species:Caenorhabditis elegans


Alignment Length:166 Identity:60/166 - (36%)
Similarity:96/166 - (57%) Gaps:0/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFASMRD 69
            ||.|:|...||||||.::|....|.|:|:.||||.:.|.|........|.:.||||.:::.....
 Worm    15 KVAVMGYPHVGKSALVLRFTQNIFPERYESTIEDQHSKHIAAFHRDYHLRVTDTAGQQEYTVFPR 79

  Fly    70 LYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAEGNAL 134
            ....:.:|||::|::.:.::|:..|::...|.|..|....||::|.||.||..||.|...||..|
 Worm    80 SCSLDINGFILVYAIDDRKSFEMCSNIYEKIVRTYGDTSIPIVIVGNKTDLSTQRVVRAEEGEEL 144

  Fly   135 AQLWDCPFIEASAKDRINVNEVFATIVREMNLTQEN 170
            |:.||..|:|.:|::...|:|||..::||:.:::.|
 Worm   145 ARQWDAKFVEITARESNRVHEVFELLLREIEISRGN 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 53/148 (36%)
rheb-1NP_499079.1 RheB 13..207 CDD:206709 60/166 (36%)
small_GTPase 13..177 CDD:197466 59/161 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.