DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and ras-1

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_496623.1 Gene:ras-1 / 174875 WormBaseID:WBGene00004310 Length:212 Species:Caenorhabditis elegans


Alignment Length:168 Identity:75/168 - (44%)
Similarity:113/168 - (67%) Gaps:0/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFASMRD 69
            ::||:|.|||||||||:||:...|::.|||||||.|.|:..||...|.||||||||.|:|::||:
 Worm    19 RIVVVGGGGVGKSALTIQFIQRYFVQDYDPTIEDSYTKQCFVDEDLCKLEILDTAGQEEFSTMRE 83

  Fly    70 LYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAEGNAL 134
            .|::.|.||::::::|:..:|:::..:..:|.|:|.....||:||.||.||:.:|.|:..|...|
 Worm    84 QYLRTGSGFLIVFAVTDRNSFEEVKKLHELICRIKDRDDFPIILVGNKADLENERHVARHEAEEL 148

  Fly   135 AQLWDCPFIEASAKDRINVNEVFATIVREMNLTQENRQ 172
            |.....|::|.|||.|.||:|.|..|||.:...|.:.:
 Worm   149 AHRLSIPYLECSAKIRKNVDEAFFDIVRLVRKYQHDER 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 67/148 (45%)
ras-1NP_496623.1 small_GTPase 30..181 CDD:197466 67/150 (45%)
M_R_Ras_like 30..179 CDD:133345 67/148 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.