DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and Rap2b

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_596901.1 Gene:Rap2b / 170923 RGDID:620591 Length:183 Species:Rattus norvegicus


Alignment Length:184 Identity:125/184 - (67%)
Similarity:148/184 - (80%) Gaps:3/184 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFA 65
            |||:||||||||||||||||||||:|.|||||||||||||||||||||||.||||||||||||||
  Rat     1 MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFA 65

  Fly    66 SMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAE 130
            ||||||||||.|||::|||.|.|:||||..|::.|.|||..:..|::||.||.||:.:||||..|
  Rat    66 SMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGE 130

  Fly   131 GNALAQLWDCPFIEASAKDRINVNEVFATIVREMNLTQENRQKKNYCC--CTLL 182
            |.|||:.|.|||:|.|||::.:|:|:||.|||:||...:....:. ||  |.:|
  Rat   131 GKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEG-CCSACVIL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 105/148 (71%)
Rap2bNP_596901.1 Rap2 3..165 CDD:133376 117/161 (73%)
Effector region. /evidence=ECO:0000305 32..40 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I2280
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H55701
Inparanoid 1 1.050 248 1.000 Inparanoid score I3166
OMA 1 1.010 - - QHG48239
OrthoDB 1 1.010 - - D1353024at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 1 1.000 - - otm45038
orthoMCL 1 0.900 - - OOG6_106771
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X266
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.