DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and Rap2a

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_446193.1 Gene:Rap2a / 114560 RGDID:620590 Length:105 Species:Rattus norvegicus


Alignment Length:104 Identity:88/104 - (84%)
Similarity:95/104 - (91%) Gaps:0/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFA 65
            |||:||||||||||||||||||||:|.|||||||||||||||||||||||.||||||||||||||
  Rat     1 MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFA 65

  Fly    66 SMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVK 104
            ||||||||||.|||::|||.|.|:||||..|::.|.|||
  Rat    66 SMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 74/89 (83%)
Rap2aNP_446193.1 P-loop_NTPase 16..>105 CDD:304359 74/89 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I2280
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I3166
OMA 1 1.010 - - QHG48239
OrthoDB 1 1.010 - - D1353024at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 1 1.000 - - otm45038
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X266
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.