DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and rras

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001107720.1 Gene:rras / 100135709 XenbaseID:XB-GENE-493188 Length:203 Species:Xenopus tropicalis


Alignment Length:193 Identity:81/193 - (41%)
Similarity:120/193 - (62%) Gaps:11/193 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFA 65
            :.::|:||:|.|||||||||:||:...|:..|||||||.|.|...:|.....|:||||||.|:|.
 Frog    11 VEKYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICSIDGKQTRLDILDTAGQEEFG 75

  Fly    66 SMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAE 130
            :||:.|::.|.||::::::.:..:|.::|.....|.|||.....|::||.||.|||.||:|:..|
 Frog    76 AMREQYMRTGEGFLLIFAINDRGSFNEMSKFHTQILRVKDRDEFPMILVGNKADLDLQRQVTKEE 140

  Fly   131 GNALAQLWDCPFIEASAKDRINVNEVFATIVREMNLTQE---------NRQKK--NYCCCTLL 182
            ..:.|:....|::|||||.|:||:|.|..:||.:...||         |.:||  ..|.|.:|
 Frog   141 ALSFARENHIPYMEASAKIRLNVDESFHELVRAIRKFQELECPPTPAVNPKKKESKSCPCVIL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 65/148 (44%)
rrasNP_001107720.1 M_R_Ras_like 12..175 CDD:133345 73/162 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.