DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and rap2ab

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001139177.1 Gene:rap2ab / 100003903 ZFINID:ZDB-GENE-090312-116 Length:183 Species:Danio rerio


Alignment Length:183 Identity:124/183 - (67%)
Similarity:149/183 - (81%) Gaps:3/183 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFA 65
            |||:||||||||||||||||||||:|.|||||||||||||||||||||||.||||||||||||||
Zfish     1 MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFA 65

  Fly    66 SMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAE 130
            ||||||||||.|||::|||.|.|:||||..|::.|.|||..:..|::||.||.|||.:||||::|
Zfish    66 SMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPVILVGNKVDLDNEREVSSSE 130

  Fly   131 GNALAQLWDCPFIEASAKDRINVNEVFATIVREMNLTQENRQKKNYCC--CTL 181
            |.|||:.|.|||:|.|||.:..|:|:|:.|||:|:...: ..|::.||  |.:
Zfish   131 GQALAEEWGCPFMETSAKSKTMVDELFSEIVRQMDYASQ-PDKEDPCCSSCNI 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 105/148 (71%)
rap2abNP_001139177.1 Rap2 16..165 CDD:133376 105/148 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 236 1.000 Domainoid score I2274
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I3232
OMA 1 1.010 - - QHG48239
OrthoDB 1 1.010 - - D1353024at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 1 1.000 - - otm25491
orthoMCL 1 0.900 - - OOG6_106771
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3491
SonicParanoid 1 1.000 - - X266
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.