Sequence 1: | NP_001369164.1 | Gene: | KCNQ2 / 3785 | HGNCID: | 6296 | Length: | 890 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001368973.1 | Gene: | CG42340 / 7354472 | FlyBaseID: | FBgn0259242 | Length: | 759 | Species: | Drosophila melanogaster |
Alignment Length: | 391 | Identity: | 72/391 - (18%) |
---|---|---|---|
Similarity: | 123/391 - (31%) | Gaps: | 150/391 - (38%) |
- Green bases have known domain annotations that are detailed below.
Human 241 LCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRL---LAATFTLIGV 302
Human 303 SFFALPAGILGSGFALKVQEQHRQKHFEKR-----------------RNPAA----------GLI 340
Human 341 QSAWRFYATNLSRTD------LHSTWQY--------------------YERTVT----------- 368
Human 369 ----VPMYSSQTQTYGASRL-IPP-------------------LNQLELLRNLKSKSGLAF---- 405
Human 406 ----------------RKDPPPEPSPSQKVSLKDR--------------VFSSPRGVAAKGKGSP 440
Human 441 QAQTVRRSPSADQSLEDSPSKVPKSWSFGDRSRARQAFRIKGAASRQNSEEASLPGEDIVDDKSC 505
Human 506 P 506 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
KCNQ2 | NP_001369164.1 | Ion_trans | 92..324 | CDD:395416 | 18/85 (21%) |
KCNQ_channel | 448..669 | CDD:397540 | 15/59 (25%) | ||
KCNQ2_u3 | 684..774 | CDD:406935 | |||
KCNQC3-Ank-G_bd | 786..886 | CDD:403240 | |||
CG42340 | NP_001368973.1 | Ion_trans_2 | <208..264 | CDD:400301 | |
Ion_trans_2 | 380..453 | CDD:400301 | 17/78 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D774951at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |