DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ2 and CG42340

DIOPT Version :9

Sequence 1:NP_001369164.1 Gene:KCNQ2 / 3785 HGNCID:6296 Length:890 Species:Homo sapiens
Sequence 2:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster


Alignment Length:391 Identity:72/391 - (18%)
Similarity:123/391 - (31%) Gaps:150/391 - (38%)


- Green bases have known domain annotations that are detailed below.


Human   241 LCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRL---LAATFTLIGV 302
            ||.:.:..:::  .|.:|   .:..::|::...:|.|||:|:..|   ||.:   .|:.:.|:|:
  Fly   382 LCYVSSGAILF--HKLQN---WSVLESLYFCFTSLGTIGFGEMAP---NGAVALYTASAYILVGM 438

Human   303 SFFALPAGILGSGFALKVQEQHRQKHFEKR-----------------RNPAA----------GLI 340
            :..|:...::.:...|.::....|.|...:                 :.|:|          ||.
  Fly   439 AVVAMCFSLIQTEIVLWLRRFSVQDHVMPKAEELALVTVAVTPKPSXQRPSADPSLGVGLGVGLA 503

Human   341 QSAWRFYATNLSRTD------LHSTWQY--------------------YERTVT----------- 368
            ..|......||.:..      .|:..||                    ::|...           
  Fly   504 GGALGQPQNNLGQHQTMFFGPAHTLTQYSSLPRRSHLQAANNSGGGSAFQRNTPIRRSTGIPEHH 568

Human   369 ----VPMYSSQTQTYGASRL-IPP-------------------LNQLELLRNLKSKSGLAF---- 405
                ||...|:....|...| :||                   :|...:..|:....||..    
  Fly   569 LEYFVPRSISEFNLSGVGDLALPPPRRYSPNMVGGGGGMGGMGMNMGGMGMNMGMGMGLPHGLQL 633

Human   406 ----------------RKDPPPEPSPSQKVSLKDR--------------VFSSPRGVAAKGKGSP 440
                            ::.|||.|:..|.|:||.|              |.....|..|.|.|:|
  Fly   634 GPPQTLLCSAAPTVQQQQQPPPPPAQLQIVTLKPRSEKMVTFEDESKQAVGGGAVGGVAGGSGTP 698

Human   441 QAQTVRRSPSADQSLEDSPSKVPKSWSFGDRSRARQAFRIKGAASRQNSEEASLPGEDIVDDKSC 505
                    |.....:..:|.|.|   :.||      .|...||.:.....:|::...|.:||..|
  Fly   699 --------PHCPHGVPTTPRKSP---AVGD------IFMXPGAQNEAAQVDAAMRLRDSIDDALC 746

Human   506 P 506
            |
  Fly   747 P 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQ2NP_001369164.1 Ion_trans 92..324 CDD:395416 18/85 (21%)
KCNQ_channel 448..669 CDD:397540 15/59 (25%)
KCNQ2_u3 684..774 CDD:406935
KCNQC3-Ank-G_bd 786..886 CDD:403240
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301
Ion_trans_2 380..453 CDD:400301 17/78 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.