DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNQ2 and RpL37-1

DIOPT Version :10

Sequence 1:NP_001369164.1 Gene:KCNQ2 / 3785 HGNCID:6296 Length:890 Species:Homo sapiens
Sequence 2:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster


Alignment Length:31 Identity:9/31 - (29%)
Similarity:13/31 - (41%) Gaps:8/31 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   821 SGFSISQSKENLDALNSCYAAVAPCAKVRPY 851
            |.:.|.:|        :|.....|.||:|.|
  Fly    25 SSYHIQKS--------TCAQCGYPAAKLRSY 47

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNQ2NP_001369164.1 Ion_trans 92..324 CDD:459842
KCNQ_channel 448..669 CDD:460954
KCNQ2_u3 683..774 CDD:465213
KCNQC3-Ank-G_bd 786..886 CDD:463411 9/31 (29%)
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 9/31 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.