DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL39 and gltX

DIOPT Version :10

Sequence 1:NP_477314.1 Gene:RpL39 / 37849 FlyBaseID:FBgn0023170 Length:51 Species:Drosophila melanogaster
Sequence 2:NP_416899.1 Gene:gltX / 946906 ECOCYCID:EG10407 Length:471 Species:Escherichia coli


Alignment Length:41 Identity:10/41 - (24%)
Similarity:21/41 - (51%) Gaps:8/41 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRH 43
            |:|.:..|::| :.|::.       ::..|...||:.:.||
E. coli    95 AYKCYCSKERL-EALREE-------QMAKGEKPRYDGRCRH 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL39NP_477314.1 Ribosomal_L39 <20..50 CDD:425894 5/24 (21%)
gltXNP_416899.1 gltX_bact 2..466 CDD:273092 10/41 (24%)

Return to query results.
Submit another query.