powered by:
Protein Alignment RpL39 and GLN4
DIOPT Version :9
Sequence 1: | NP_477314.1 |
Gene: | RpL39 / 37849 |
FlyBaseID: | FBgn0023170 |
Length: | 51 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_014811.3 |
Gene: | GLN4 / 854339 |
SGDID: | S000005694 |
Length: | 809 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 39 |
Identity: | 10/39 - (25%) |
Similarity: | 20/39 - (51%) |
Gaps: | 4/39 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 HKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRR 42
|.::..|.:...|.|:.::..|||.:.: :||:..|
Yeast 665 HVNYDNKVEEGSKPKKPKTYIQWVPISS----KYNSPLR 699
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0008 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.