DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL39 and GLN4

DIOPT Version :9

Sequence 1:NP_477314.1 Gene:RpL39 / 37849 FlyBaseID:FBgn0023170 Length:51 Species:Drosophila melanogaster
Sequence 2:NP_014811.3 Gene:GLN4 / 854339 SGDID:S000005694 Length:809 Species:Saccharomyces cerevisiae


Alignment Length:39 Identity:10/39 - (25%)
Similarity:20/39 - (51%) Gaps:4/39 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRR 42
            |.::..|.:...|.|:.::..|||.:.:    :||:..|
Yeast   665 HVNYDNKVEEGSKPKKPKTYIQWVPISS----KYNSPLR 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL39NP_477314.1 Ribosomal_L39 <20..50 CDD:395670 6/23 (26%)
GLN4NP_014811.3 tRNA_synt_1c_R1 5..163 CDD:398315
tRNA_synt_1c_R2 166..244 CDD:398314
glnS 252..807 CDD:273079 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0008
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.