DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL39 and AT2G25210

DIOPT Version :10

Sequence 1:NP_477314.1 Gene:RpL39 / 37849 FlyBaseID:FBgn0023170 Length:51 Species:Drosophila melanogaster
Sequence 2:NP_180093.1 Gene:AT2G25210 / 817059 AraportID:AT2G25210 Length:44 Species:Arabidopsis thaliana


Alignment Length:41 Identity:32/41 - (78%)
Similarity:37/41 - (90%) Gaps:0/41 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKL 49
            ||:||.||::|||.:|.|:||||.|||||||||||||||||
plant     2 IKKKLGKKMRQNRPIPHWIRLRTDNTIRYNAKRRHWRRTKL 42

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL39NP_477314.1 Ribosomal_L39 <20..50 CDD:425894 25/30 (83%)
AT2G25210NP_180093.1 Ribosomal_L39 3..43 CDD:425894 31/40 (78%)

Return to query results.
Submit another query.