DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL39 and Rpl39l

DIOPT Version :10

Sequence 1:NP_477314.1 Gene:RpL39 / 37849 FlyBaseID:FBgn0023170 Length:51 Species:Drosophila melanogaster
Sequence 2:NP_080870.1 Gene:Rpl39l / 68172 MGIID:1915422 Length:51 Species:Mus musculus


Alignment Length:51 Identity:36/51 - (70%)
Similarity:45/51 - (88%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLKL 51
            ||:||:||||:.||||.||||.:|||::::|||.|.||:||||||||||.|
Mouse     1 MASHKTFRIKRFLAKKQKQNRPIPQWIQMKTGNKIMYNSKRRHWRRTKLGL 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL39NP_477314.1 Ribosomal_L39 <20..50 CDD:425894 20/29 (69%)
Rpl39lNP_080870.1 Ribosomal_L39 10..50 CDD:425894 27/39 (69%)

Return to query results.
Submit another query.