powered by:
Protein Alignment RpL39 and Ears2
DIOPT Version :9
Sequence 1: | NP_477314.1 |
Gene: | RpL39 / 37849 |
FlyBaseID: | FBgn0023170 |
Length: | 51 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_080416.1 |
Gene: | Ears2 / 67417 |
MGIID: | 1914667 |
Length: | 523 |
Species: | Mus musculus |
Alignment Length: | 42 |
Identity: | 12/42 - (28%) |
Similarity: | 20/42 - (47%) |
Gaps: | 8/42 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 AAHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRH 43
||:..|.:.|:|....|: .||:..|.||:.:.|:
Mouse 136 AAYPCFCLPQRLELLKKE--------ALRSRQTPRYDNRCRN 169
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0008 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.