DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL39 and rpl39

DIOPT Version :9

Sequence 1:NP_477314.1 Gene:RpL39 / 37849 FlyBaseID:FBgn0023170 Length:51 Species:Drosophila melanogaster
Sequence 2:NP_001342745.1 Gene:rpl39 / 2539277 PomBaseID:SPCC663.04 Length:51 Species:Schizosaccharomyces pombe


Alignment Length:51 Identity:37/51 - (72%)
Similarity:43/51 - (84%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLKL 51
            |.:|||||.||||||..:|||.:|||:|||||||:.||.||||||||||.:
pombe     1 MPSHKSFRTKQKLAKAARQNRPIPQWIRLRTGNTVHYNMKRRHWRRTKLNI 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL39NP_477314.1 Ribosomal_L39 <20..50 CDD:395670 23/29 (79%)
rpl39NP_001342745.1 RPL39 1..51 CDD:225078 37/49 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 74 1.000 Domainoid score I2540
eggNOG 1 0.900 - - E1_COG0008
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I1787
OMA 1 1.010 - - QHG54089
OrthoFinder 1 1.000 - - FOG0002769
OrthoInspector 1 1.000 - - oto101923
orthoMCL 1 0.900 - - OOG6_101109
Panther 1 1.100 - - LDO PTHR19970
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1135
SonicParanoid 1 1.000 - - X1859
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.