DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL39 and EARS2

DIOPT Version :9

Sequence 1:NP_477314.1 Gene:RpL39 / 37849 FlyBaseID:FBgn0023170 Length:51 Species:Drosophila melanogaster
Sequence 2:NP_001295140.1 Gene:EARS2 / 124454 HGNCID:29419 Length:534 Species:Homo sapiens


Alignment Length:42 Identity:12/42 - (28%)
Similarity:18/42 - (42%) Gaps:8/42 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRH 43
            ||:..|...|:|....|:        .||...|.||:.:.|:
Human   136 AAYPCFCSPQRLELLKKE--------ALRNHQTPRYDNRCRN 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL39NP_477314.1 Ribosomal_L39 <20..50 CDD:395670 6/24 (25%)
EARS2NP_001295140.1 GluRS_core 36..361 CDD:173905 12/42 (29%)
gltX 37..508 CDD:234953 12/42 (29%)
Glutamate binding. /evidence=ECO:0000250 40..42
'HIGH' region 45..53
Glutamate binding. /evidence=ECO:0000250 228..232
'KMSKS' region 284..288
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0008
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.