Sequence 1: | NP_477314.1 | Gene: | RpL39 / 37849 | FlyBaseID: | FBgn0023170 | Length: | 51 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_443201.1 | Gene: | RPL39L / 116832 | HGNCID: | 17094 | Length: | 51 | Species: | Homo sapiens |
Alignment Length: | 51 | Identity: | 33/51 - (64%) |
---|---|---|---|
Similarity: | 44/51 - (86%) | Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAAHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLKL 51 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RpL39 | NP_477314.1 | Ribosomal_L39 | <20..50 | CDD:395670 | 19/29 (66%) |
RPL39L | NP_443201.1 | Ribosomal_L39 | 9..50 | CDD:307122 | 27/40 (68%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 74 | 1.000 | Domainoid score | I9135 |
eggNOG | 1 | 0.900 | - | - | E1_COG0008 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 86 | 1.000 | Inparanoid score | I5160 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG54089 | |
OrthoDB | 1 | 1.010 | - | - | D1618745at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0002769 | |
OrthoInspector | 1 | 1.000 | - | - | otm42045 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_101109 | |
Panther | 1 | 1.100 | - | - | O | PTHR19970 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X1859 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
12 | 11.880 |