DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL39 and LOC103691460

DIOPT Version :9

Sequence 1:NP_477314.1 Gene:RpL39 / 37849 FlyBaseID:FBgn0023170 Length:51 Species:Drosophila melanogaster
Sequence 2:XP_008758964.1 Gene:LOC103691460 / 103691460 RGDID:9476424 Length:50 Species:Rattus norvegicus


Alignment Length:51 Identity:32/51 - (62%)
Similarity:42/51 - (82%) Gaps:1/51 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLKL 51
            |.:||:|||||.||||.||:|.:|||:.::|.|.||||::|||| ||:|.|
  Rat     1 MTSHKTFRIKQFLAKKQKQSRPIPQWIWMKTDNKIRYNSRRRHW-RTQLDL 50

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL39NP_477314.1 Ribosomal_L39 <20..50 CDD:395670 16/29 (55%)
LOC103691460XP_008758964.1 Ribosomal_L39 9..45 CDD:395670 23/36 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1618745at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.