powered by:
Protein Alignment RpL39 and LOC103691460
DIOPT Version :9
Sequence 1: | NP_477314.1 |
Gene: | RpL39 / 37849 |
FlyBaseID: | FBgn0023170 |
Length: | 51 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_008758964.1 |
Gene: | LOC103691460 / 103691460 |
RGDID: | 9476424 |
Length: | 50 |
Species: | Rattus norvegicus |
Alignment Length: | 51 |
Identity: | 32/51 - (62%) |
Similarity: | 42/51 - (82%) |
Gaps: | 1/51 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAAHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLKL 51
|.:||:|||||.||||.||:|.:|||:.::|.|.||||::|||| ||:|.|
Rat 1 MTSHKTFRIKQFLAKKQKQSRPIPQWIWMKTDNKIRYNSRRRHW-RTQLDL 50
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1618745at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.