DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL39 and Rpl39l5

DIOPT Version :10

Sequence 1:NP_477314.1 Gene:RpL39 / 37849 FlyBaseID:FBgn0023170 Length:51 Species:Drosophila melanogaster
Sequence 2:XP_008758964.1 Gene:Rpl39l5 / 103691460 RGDID:9476424 Length:50 Species:Rattus norvegicus


Alignment Length:51 Identity:32/51 - (62%)
Similarity:42/51 - (82%) Gaps:1/51 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLKL 51
            |.:||:|||||.||||.||:|.:|||:.::|.|.||||::|||| ||:|.|
  Rat     1 MTSHKTFRIKQFLAKKQKQSRPIPQWIWMKTDNKIRYNSRRRHW-RTQLDL 50

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL39NP_477314.1 Ribosomal_L39 <20..50 CDD:425894 16/29 (55%)
Rpl39l5XP_008758964.1 Ribosomal_L39 10..45 CDD:425894 22/35 (63%)

Return to query results.
Submit another query.