DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL39 and rpl39

DIOPT Version :10

Sequence 1:NP_477314.1 Gene:RpL39 / 37849 FlyBaseID:FBgn0023170 Length:51 Species:Drosophila melanogaster
Sequence 2:NP_001165135.1 Gene:rpl39 / 100135132 XenbaseID:XB-GENE-5895526 Length:51 Species:Xenopus tropicalis


Alignment Length:51 Identity:36/51 - (70%)
Similarity:46/51 - (90%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLKL 51
            |::||:|:||:.||||.||||.:|||:|::|||.||||:||||||||||.|
 Frog     1 MSSHKTFKIKRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLGL 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL39NP_477314.1 Ribosomal_L39 <20..50 CDD:425894 22/29 (76%)
rpl39NP_001165135.1 Ribosomal_L39 10..50 CDD:425894 29/39 (74%)

Return to query results.
Submit another query.