DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF5 and eif5a2

DIOPT Version :9

Sequence 1:NP_611878.1 Gene:eEF5 / 37846 FlyBaseID:FBgn0285952 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_998427.1 Gene:eif5a2 / 406546 ZFINID:ZDB-GENE-040426-2405 Length:155 Species:Danio rerio


Alignment Length:152 Identity:107/152 - (70%)
Similarity:129/152 - (84%) Gaps:1/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMVGIDIF 65
            ||:||..|.:.|:|||.|:|||||||||||||:||.|||||||||||||||||||||||||||||
Zfish     1 MADLDTDFTSGDAGASLTFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHMVGIDIF 65

  Fly    66 SNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGELGEQLRLDFD 130
            :.||.||||||||||||||:||:|.||:.|. |.:|:||.::||||:|||:|||:||:::...|:
Zfish    66 TGKKNEDICPSTHNMDVPNIKRQDYQLVGII-DGYLSLMKDNGDLRDDLKLPEGDLGKEIESKFE 129

  Fly   131 SGKDLLCTVLKACGEECVIAIK 152
            ||.:.|.:||.|.||||.||||
Zfish   130 SGDEFLVSVLAAMGEECPIAIK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF5NP_611878.1 PLN03107 1..152 CDD:215580 105/150 (70%)
eIF-5a 84..152 CDD:279611 36/67 (54%)
eif5a2NP_998427.1 PLN03107 1..151 CDD:215580 105/150 (70%)
S1_eIF5A 85..153 CDD:239914 37/68 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583725
Domainoid 1 1.000 151 1.000 Domainoid score I4323
eggNOG 1 0.900 - - E1_COG0231
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 224 1.000 Inparanoid score I3495
OMA 1 1.010 - - QHG53968
OrthoDB 1 1.010 - - D1370513at2759
OrthoFinder 1 1.000 - - FOG0001335
OrthoInspector 1 1.000 - - otm24599
orthoMCL 1 0.900 - - OOG6_100628
Panther 1 1.100 - - O PTHR11673
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X827
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.