DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF5 and Eif5a

DIOPT Version :9

Sequence 1:NP_611878.1 Gene:eEF5 / 37846 FlyBaseID:FBgn0285952 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001160061.1 Gene:Eif5a / 276770 MGIID:106248 Length:154 Species:Mus musculus


Alignment Length:152 Identity:104/152 - (68%)
Similarity:128/152 - (84%) Gaps:2/152 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMVGIDIF 65
            ||: |..|||.|:|||.|:|||||||||||||:||.||||||||||||||||||||||:||||||
Mouse     1 MAD-DLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIF 64

  Fly    66 SNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGELGEQLRLDFD 130
            :.|||||||||||||||||:||.|.|||.| .|.:|:|:.:||::||||::|||:||:::...:|
Mouse    65 TGKKYEDICPSTHNMDVPNIKRNDFQLIGI-QDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYD 128

  Fly   131 SGKDLLCTVLKACGEECVIAIK 152
            .|:::|.|||.|..||..:|||
Mouse   129 CGEEILITVLSAMTEEAAVAIK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF5NP_611878.1 PLN03107 1..152 CDD:215580 102/150 (68%)
eIF-5a 84..152 CDD:279611 32/67 (48%)
Eif5aNP_001160061.1 PLN03107 1..150 CDD:357685 102/150 (68%)
Nuclear localization regulation 2..19 10/17 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839637
Domainoid 1 1.000 148 1.000 Domainoid score I4450
eggNOG 1 0.900 - - E1_COG0231
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 218 1.000 Inparanoid score I3572
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53968
OrthoDB 1 1.010 - - D1370513at2759
OrthoFinder 1 1.000 - - FOG0001335
OrthoInspector 1 1.000 - - otm43968
orthoMCL 1 0.900 - - OOG6_100628
Panther 1 1.100 - - LDO PTHR11673
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2157
SonicParanoid 1 1.000 - - X827
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.