DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF5 and Eif5a2

DIOPT Version :9

Sequence 1:NP_611878.1 Gene:eEF5 / 37846 FlyBaseID:FBgn0285952 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_808254.1 Gene:Eif5a2 / 208691 MGIID:1933735 Length:153 Species:Mus musculus


Alignment Length:150 Identity:103/150 - (68%)
Similarity:128/150 - (85%) Gaps:3/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMVGIDIFSN 67
            |:|  |.|.|:|||:|||||||||||||||:||.||||||||||||||||||||||:||||||:.
Mouse     4 EID--FTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTG 66

  Fly    68 KKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGELGEQLRLDFDSG 132
            |||||||||||||||||:||.|.|||.| .|.:|:|:||:|::|||||:||||||:::...:::|
Mouse    67 KKYEDICPSTHNMDVPNIKRNDYQLICI-QDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAG 130

  Fly   133 KDLLCTVLKACGEECVIAIK 152
            :|:..:|:.|..||..:|||
Mouse   131 EDVQVSVMCAMSEEYAVAIK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF5NP_611878.1 PLN03107 1..152 CDD:215580 101/148 (68%)
eIF-5a 84..152 CDD:279611 32/67 (48%)
Eif5a2NP_808254.1 PLN03107 1..150 CDD:357685 101/148 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839638
Domainoid 1 1.000 148 1.000 Domainoid score I4450
eggNOG 1 0.900 - - E1_COG0231
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 218 1.000 Inparanoid score I3572
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53968
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001335
OrthoInspector 1 1.000 - - otm43968
orthoMCL 1 0.900 - - OOG6_100628
Panther 1 1.100 - - O PTHR11673
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2157
SonicParanoid 1 1.000 - - X827
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.