DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF5 and EIF5A

DIOPT Version :9

Sequence 1:NP_611878.1 Gene:eEF5 / 37846 FlyBaseID:FBgn0285952 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_024306398.1 Gene:EIF5A / 1984 HGNCID:3300 Length:216 Species:Homo sapiens


Alignment Length:184 Identity:105/184 - (57%)
Similarity:129/184 - (70%) Gaps:34/184 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMVGIDIF 65
            ||: |..|||.|:|||.|:|||||||||||||:||.||||||||||||||||||||||:||||||
Human    31 MAD-DLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIF 94

  Fly    66 SNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGELGEQLRLDFD 130
            :.|||||||||||||||||:||.|.|||.| .|.:|:|:.:||::||||::|||:||:::...:|
Human    95 TGKKYEDICPSTHNMDVPNIKRNDFQLIGI-QDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYD 158

  Fly   131 SGKDL------------LC--------------------TVLKACGEECVIAIK 152
            .|:::            ||                    |||.|..||..:|||
Human   159 CGEEILVWCLPPCFCAQLCSVRFFLSSDISWLSLLLLQITVLSAMTEEAAVAIK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF5NP_611878.1 PLN03107 1..152 CDD:215580 103/182 (57%)
eIF-5a 84..152 CDD:279611 33/99 (33%)
EIF5AXP_024306398.1 PRK03999 31..212 CDD:333252 103/182 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149574
Domainoid 1 1.000 148 1.000 Domainoid score I4470
eggNOG 1 0.900 - - E1_COG0231
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 218 1.000 Inparanoid score I3587
Isobase 1 0.950 - 0 Normalized mean entropy S164
OMA 1 1.010 - - QHG53968
OrthoDB 1 1.010 - - D1370513at2759
OrthoFinder 1 1.000 - - FOG0001335
OrthoInspector 1 1.000 - - otm41920
orthoMCL 1 0.900 - - OOG6_100628
Panther 1 1.100 - - LDO PTHR11673
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2157
SonicParanoid 1 1.000 - - X827
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.750

Return to query results.
Submit another query.