DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF5 and iff-1

DIOPT Version :9

Sequence 1:NP_611878.1 Gene:eEF5 / 37846 FlyBaseID:FBgn0285952 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001255020.1 Gene:iff-1 / 176373 WormBaseID:WBGene00002064 Length:195 Species:Caenorhabditis elegans


Alignment Length:154 Identity:93/154 - (60%)
Similarity:120/154 - (77%) Gaps:5/154 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMVGIDIFSNKK 69
            ::||::.:|||:.|:|.||||||||..||::.||||||||||||||||||||||||.||||:.||
 Worm    42 EEQFDSAESGAAATFPKQCSALRKNEHVMIRGRPCKIVEMSTSKTGKHGHAKVHMVAIDIFTTKK 106

  Fly    70 YEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLM-TESGDLREDLKVPEGELGEQLR--LDFDS 131
            .|||||||||||||.|||.:..|::| :|.|.:|| .||.:|::|||:|||:||..:|  |:.|.
 Worm   107 LEDICPSTHNMDVPVVKRREYILMSI-EDGFCSLMDPESCELKDDLKMPEGDLGNTIREALEKDE 170

  Fly   132 GKDLLCTVLKACGEECVIAIKTNT 155
            | .:|..|:.|||||.::..|.:|
 Worm   171 G-SVLVQVVAACGEEAILGYKIST 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF5NP_611878.1 PLN03107 1..152 CDD:215580 91/149 (61%)
eIF-5a 84..152 CDD:279611 31/70 (44%)
iff-1NP_001255020.1 PLN03107 40..190 CDD:215580 91/149 (61%)
S1_eIF5A 122..192 CDD:239914 32/71 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161029
Domainoid 1 1.000 137 1.000 Domainoid score I3033
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100947
Inparanoid 1 1.050 183 1.000 Inparanoid score I2628
Isobase 1 0.950 - 0 Normalized mean entropy S164
OMA 1 1.010 - - QHG53968
OrthoDB 1 1.010 - - D1370513at2759
OrthoFinder 1 1.000 - - FOG0001335
OrthoInspector 1 1.000 - - otm14616
orthoMCL 1 0.900 - - OOG6_100628
Panther 1 1.100 - - LDO PTHR11673
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2157
SonicParanoid 1 1.000 - - X827
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.890

Return to query results.
Submit another query.