DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF5 and EIF5AL1

DIOPT Version :9

Sequence 1:NP_611878.1 Gene:eEF5 / 37846 FlyBaseID:FBgn0285952 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001093162.1 Gene:EIF5AL1 / 143244 HGNCID:17419 Length:154 Species:Homo sapiens


Alignment Length:152 Identity:101/152 - (66%)
Similarity:125/152 - (82%) Gaps:2/152 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMVGIDIF 65
            ||: |..|||.|:|||.|:|||||||||||||:||..||||||||.||||||||||||:||||||
Human     1 MAD-DLDFETGDAGASATFPMQCSALRKNGFVVLKGWPCKIVEMSASKTGKHGHAKVHLVGIDIF 64

  Fly    66 SNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGELGEQLRLDFD 130
            :.|||||||||||||||||:||.|.|||.| .|.:|:|:.:||::.|||::|||:||:::...:|
Human    65 TGKKYEDICPSTHNMDVPNIKRNDFQLIGI-QDGYLSLLQDSGEVPEDLRLPEGDLGKEIEQKYD 128

  Fly   131 SGKDLLCTVLKACGEECVIAIK 152
            .|:::|.|||.|..||..:|||
Human   129 CGEEILITVLSAMTEEAAVAIK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF5NP_611878.1 PLN03107 1..152 CDD:215580 99/150 (66%)
eIF-5a 84..152 CDD:279611 31/67 (46%)
EIF5AL1NP_001093162.1 PLN03107 1..150 CDD:215580 99/150 (66%)
S1_eIF5A 84..152 CDD:239914 32/68 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149575
Domainoid 1 1.000 148 1.000 Domainoid score I4470
eggNOG 1 0.900 - - E1_COG0231
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100947
Inparanoid 1 1.050 218 1.000 Inparanoid score I3587
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53968
OrthoDB 1 1.010 - - D1370513at2759
OrthoFinder 1 1.000 - - FOG0001335
OrthoInspector 1 1.000 - - otm41920
orthoMCL 1 0.900 - - OOG6_100628
Panther 1 1.100 - - O PTHR11673
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X827
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.