DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdh1 and Adhr

DIOPT Version :9

Sequence 1:NP_932335.1 Gene:rdh1 / 378440 ZFINID:ZDB-GENE-030912-15 Length:327 Species:Danio rerio
Sequence 2:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster


Alignment Length:139 Identity:36/139 - (25%)
Similarity:62/139 - (44%) Gaps:34/139 - (24%)


- Green bases have known domain annotations that are detailed below.


Zfish   132 MDWMQL----------HDFKKVLDVNLTGVIAVTLKFLPLLKKAQ----GRVVNVASMLG-RLSI 181
            ||::.:          ::....::.||||::......||.:.:..    |.:|||.|::| ..|.
  Fly    83 MDYIDVLINGATLCDENNIDATINTNLTGMMNTVATVLPYMDRKMGGTGGLIVNVTSVIGLDPSP 147

Zfish   182 IGGGYCLSKFGVEAFSDSLRRDMVHF---GVKVSIIEPGFFKTQVTDLGLIEDDLKKRWSNLPEQ 243
            :...|..|||||..|:.|| .|.:::   ||.|..:..|  .|:|    .::.:||         
  Fly   148 VFCAYSASKFGVIGFTRSL-ADPLYYSQNGVAVMAVCCG--PTRV----FVDRELK--------- 196

Zfish   244 VRRDYGDSY 252
            ...:||.|:
  Fly   197 AFLEYGQSF 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdh1NP_932335.1 NADB_Rossmann 40..316 CDD:304358 36/139 (26%)
adh_short 40..224 CDD:278532 30/109 (28%)
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 36/139 (26%)
adh_short 7..195 CDD:278532 31/118 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.