DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and SCNN1D

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001123885.2 Gene:SCNN1D / 6339 HGNCID:10601 Length:802 Species:Homo sapiens


Alignment Length:372 Identity:64/372 - (17%)
Similarity:124/372 - (33%) Gaps:115/372 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 YNFNILDIRRKM--------------FPTNCTECFKEIYFRGELVTDCE--EIFKFHVTEMGYCF 174
            |:|:.:||...:              |..:|:       :.|   .||:  :...||....|.|:
Human   397 YHFHYVDILALLPAAWEDSHGSQDGHFVLSCS-------YDG---LDCQARQFRTFHHPTYGSCY 451

  Fly   175 LANN---------------LLDYDSIEEMPLRYSSLDNNRSLRLYMRSSVMYKYEMYVNSPEDLP 224
            ..:.               :|..:....:||                .|.:....:.|:.....|
Human   452 TVDGVWTAQRPGITHGVGLVLRVEQQPHLPL----------------LSTLAGIRVMVHGRNHTP 500

  Fly   225 FFNSLTYTI--STDPTTYAFNVEEIHNHEGVIDEPISQRKCKFPSE----SSIEGFPYSFSACMS 283
            |....::::  .|: .|.:...:|:|.    :..|...  |....|    ..:....|:..||:.
Human   501 FLGHHSFSVRPGTE-ATISIREDEVHR----LGSPYGH--CTAGGEGVEVELLHNTSYTRQACLV 558

  Fly   284 IIRSEFEMKTCDCSLF-NPKDRNESLYCGLQ------HADCLIKEGFATRVKEYVGSSTVCLPSC 341
            ....:..::||.|..: :|...... ||...      |....:.:...|   ..:..::.|...|
Human   559 SCFQQLMVETCSCGYYLHPLPAGAE-YCSSARHPAWGHCFYRLYQDLET---HRLPCTSRCPRPC 619

  Fly   342 VEQQISL----------------VGVITENGTLYNNNTQ---ITEIQIASPPTVRYE----RKVT 383
            .|....|                :..:.|.|..:.::.|   :.:|.|.      |:    |.|.
Human   620 RESAFKLSTGTSRWPSAKSAGWTLATLGEQGLPHQSHRQRSSLAKINIV------YQELNYRSVE 678

  Fly   384 QTKL----DLIVGIGSVAGLFFGASLLNLLEIISYFI-KKLKTMIFG 425
            :..:    .|:..:||:..|:||||:|:|||::...: ....|::.|
Human   679 EAPVYSVPQLLSAMGSLCSLWFGASVLSLLELLELLLDASALTLVLG 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 62/359 (17%)
SCNN1DNP_001123885.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..211
ENaC 219..784 CDD:273304 64/372 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 738..777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152183
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.