DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and ASIC4

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_061144.4 Gene:ASIC4 / 55515 HGNCID:21263 Length:539 Species:Homo sapiens


Alignment Length:444 Identity:87/444 - (19%)
Similarity:150/444 - (33%) Gaps:146/444 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YETDSTTIGVSTAYSRWINTFPSIGICLTKSRAFNEFKAMMREYFQEDFAFSFTRMIYEYAFLNP 110
            |.|....:.:..|....:..||::.:|     ..|.|:                     ::.|:.
Human    92 YLTRPHLVAMDPAAPAPVAGFPAVTLC-----NINRFR---------------------HSALSD 130

  Fly   111 NNIF-----TKEPTKNTS--------YPYNFNILDIRRKMFPTNCTECFKEIYFRGELVTDCE-E 161
            .:||     |..|.|:..        || ..:::||..:. .....:..|...|.|.   .|. .
Human   131 ADIFHLANLTGLPPKDRDGHRAAGLRYP-EPDMVDILNRT-GHQLADMLKSCNFSGH---HCSAS 190

  Fly   162 IFKFHVTEMGYCFLANNLLDYDSIEEMPLRYSSLDNNRSLRL------YM---RSSVMYKYE--- 214
            .|....|..|.|:..|    .|....:|.|...:.:...:.|      |:   |.:....:|   
Human   191 NFSVVYTRYGKCYTFN----ADPRSSLPSRAGGMGSGLEIMLDIQQEEYLPIWRETNETSFEAGI 251

  Fly   215 -MYVNSPEDLPFFNSLTYTISTDPTTYAFNVEEIHNHEGVIDEPISQRKCKFPS---ESSIEGF- 274
             :.::|.|:.|:.:.|.:.:|....|:....|:...:   :.:|..  .|:..|   |..::|: 
Human   252 RVQIHSQEEPPYIHQLGFGVSPGFQTFVSCQEQRLTY---LPQPWG--NCRAESELREPELQGYS 311

  Fly   275 PYSFSACMSIIRSEFEMKTCDCSLFNPKDRNESLYCGLQHADCLIKEGFATRVKEYVGSSTVCLP 339
            .||.|||......|..::.|.|                             |:....|:.|:|.|
Human   312 AYSVSACRLRCEKEAVLQRCHC-----------------------------RMVHMPGNETICPP 347

  Fly   340 S----CVEQQISLVGVITE---------NGTLYNNNTQITEIQIASPPTVRY-ERKVTQTK---- 386
            :    |.:..:..:|...|         |.|.|..  :|:.::|.:..:.|| .||..:.:    
Human   348 NIYIECADHTLDSLGGGPEGPCFCPTPCNLTRYGK--EISMVRIPNRGSARYLARKYNRNETYIR 410

  Fly   387 -----LD---------------------LIVGIGSVAGLFFGASLLNLLEIISY 414
                 ||                     |:..:|...|||.|||:|.||||:.|
Human   411 ENFLVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIGASILTLLEILDY 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 73/362 (20%)
ASIC4NP_061144.4 ASC 40..488 CDD:413546 87/444 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152201
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.