DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and ppk21

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster


Alignment Length:485 Identity:110/485 - (22%)
Similarity:178/485 - (36%) Gaps:100/485 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IRSFVENKGLLWIFVIGISGWSTVSILVLLKTRYETDSTTIGVSTAYSRWINT--------FPSI 69
            :|::: |..::|:.::..:....:.:.|.|...|:    |:.:.|...   ||        ||||
  Fly    68 MRNYL-NIRVIWLLILLTTSIGAIVVYVDLNELYQ----TVRIQTTIK---NTMLPIFRIPFPSI 124

  Fly    70 GIC--------LTKSRAFNEFKAMMREYFQEDFAFSFTRMIYE--YAFLNPNNIFTKEPTKNTSY 124
            |:|        :.::.|.:.|........|:|....|.....:  .:.||..:.|....|. |..
  Fly   125 GLCPRNRLNWKILETEAVDHFLGANVSAAQKDLFVKFFTAAGDPHLSRLNEMSNFFGNKTL-TDE 188

  Fly   125 PYNFNILDIRR--KMFPTNCTECFKEIYFRGELVTDCEEIFKFHVTEMGYCFLANNLLDYDSIEE 187
            .:..:.||:|.  |.....|.:.|....:||..| :|.|:.::..||.|.||:.|..:...|.::
  Fly   189 LHMLDHLDLREVYKFIQFRCQDLFHTCRWRGNPV-NCCEVIEYQFTEAGLCFVFNTEISPASRQK 252

  Fly   188 ------MPLRYSSLDNNRSLRLYMR------------SSVMYKY-----EMYVNSPEDLPFFNSL 229
                  .|||.........|.|::|            .:||.|.     ::..:.|.:.....|:
  Fly   253 AREDKYYPLRTPHYGEGSGLDLFLRLNRSFIRPGKRGINVMIKQPQQWSDVVRHVPHEAHTRISI 317

  Fly   230 T--YTISTDPTTYAFNVEEIHNHEGVIDEPISQRKCKF------PSESSIEGFPYSFSACMSIIR 286
            |  :|: ||..|.....|              .|:|.|      |...:...|.|....|.|...
  Fly   318 TPRFTV-TDERTRTVTPE--------------IRRCIFGDEVDNPHYKNFPDFEYWVGNCRSRCH 367

  Fly   287 SEFEMKTCDC--SLFNP-KDRNESLYCGLQHADCLIKEGFATRVKEYVGSSTV------------ 336
            .|..:..|.|  |:|.| .|::....|......||....|...::.:......            
  Fly   368 QEHVLNLCKCSPSIFFPISDKDNFTACKASDFKCLYDNRFTFSIERHPEEDDFVKNPFKESMICD 432

  Fly   337 CLPSCVEQQISLVGVITENGTLYNNNTQI------TEIQIASPPTVRYERKVTQTKLDLIVGIGS 395
            |..||.:.....|...|   ||.||.|..      .:|...|...::|:..:..|.::|:...|.
  Fly   433 CFTSCSQLVFDRVFTTT---TLDNNETDTEAGTMRLDIFYQSGWFIQYQTNMRFTFVELLASFGG 494

  Fly   396 VAGLFFGASLLNLLEIISYFIKKLKTMIFG 425
            :.|||.|||||:..|:..||...|...|.|
  Fly   495 IIGLFLGASLLSAFELAYYFSIGLYLYIHG 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 79/345 (23%)
ppk21NP_651704.2 ASC 51..513 CDD:279230 105/472 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.