DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and asic1b

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_999956.1 Gene:asic1b / 407672 ZFINID:ZDB-GENE-040513-1 Length:557 Species:Danio rerio


Alignment Length:477 Identity:102/477 - (21%)
Similarity:175/477 - (36%) Gaps:135/477 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FVENKGL-----LW--IFVIGISGWSTVSILVLLKTRYETDSTTIGVSTAYSRWIN-------TF 66
            |||:|..     ||  :|::.||       :.||:.   .|.....:...|...::       ||
Zfish    82 FVEDKKFSIRQGLWALVFLLAIS-------MFLLQV---VDRVIYYLQYDYVTLLDERNAKNMTF 136

  Fly    67 PSIGICLTKSRAFNEFKAMMREYFQEDFAFSFTRMIYEYAFLNPNNIFTKEPTKNTSYPYNFNIL 131
            |:|.:|     .:|.|:.....|  .|..|....:.|| ..:.|......||.:..|   .|::.
Zfish   137 PAITLC-----NYNTFRRSQLSY--SDLLFMGPLLGYE-DNMAPGIPLAPEPDRQGS---RFSLA 190

  Fly   132 DI----RRKMFPTNCTECFKEIYFRGELVTDC-----EEIFKFHVTEMGYCFLANNLLDYDSIEE 187
            :.    |.:|     .:...|..|.|:   :|     .|||    |..|.|:             
Zfish   191 EFFNRTRHRM-----DDMLLECNFAGK---ECGAEHWREIF----TRYGKCY------------- 230

  Fly   188 MPLRYSSLDNNRSLRLYMRSSVMYKYEMYVNSPED--LPFFNSLTYTISTDPTTYAFNVE-EIHN 249
               .::|..:.|.|.:..:..:....|:.::..:|  ||.:.      .||.||:...:: :||.
Zfish   231 ---TFNSGQDGRPLLITTKGGMGNGLEIMLDIQQDEYLPVWG------ETDETTFEAGIKVQIHT 286

  Fly   250 HEGVIDEP-----------------IS---QR---------KCK-FPSESSIEGFPYSFSACMSI 284
            .    |||                 :|   ||         .|| .|.:|.... .||.:||...
Zfish   287 Q----DEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCKATPIDSDFFN-TYSITACRID 346

  Fly   285 IRSEFEMKTCDCSLFN-PKDRNESLYC-GLQHADCL--IKEGFATRVKEYVGSSTVCLPSCVEQQ 345
            ..:.:.::.|:|.:.: |.|   :.|| ..|:.:|.  ..:....|..:|....|.|..:...::
Zfish   347 CETRYLVENCNCRMVHMPGD---APYCTPEQYKECADPALDFLVERDNDYCVCETPCNMTRYGKE 408

  Fly   346 ISLVGVITENGTLY------------NNNTQITEIQIASPPTVRYERKVTQTKLDLIVGIGSVAG 398
            :|.|.:.::....|            ::|..:.:|...:......|:|.......|:..||...|
Zfish   409 LSFVRIPSKASAKYLAKKYNKTEQYISDNIMVLDIFFEALNYETIEQKKAYELAGLLGDIGGQMG 473

  Fly   399 LFFGASLLNLLEIISYFIKKLK 420
            ||.|||:|.:||:..|..:.:|
Zfish   474 LFIGASILTILELFDYLYEVIK 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 72/349 (21%)
asic1bNP_999956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..57
ASC 66..548 CDD:295594 102/477 (21%)
Selectivity filter. /evidence=ECO:0000305 477..479 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.