DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and asic4b

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_999951.1 Gene:asic4b / 407667 ZFINID:ZDB-GENE-040513-6 Length:558 Species:Danio rerio


Alignment Length:451 Identity:101/451 - (22%)
Similarity:165/451 - (36%) Gaps:101/451 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GLLWIFVIGI----SGWSTVSILV---LLKTRYETDSTTIGVSTAYSRWINTFPSIGICLTKSRA 78
            ||..:..:|:    :.||..:.|.   |...|.||            |...|||:|.:|     .
Zfish    74 GLALLVSLGLFLYQATWSAATYLERPHLAALREET------------RRELTFPAITLC-----N 121

  Fly    79 FNEFKAMMREYFQEDFAFSFTRMIYEYAFLN---PNNIFTKEPTKNTSYPYNFNILDIRRKMFPT 140
            .|.|:          |:......||..|.|.   |.:.....|:: ..||.. |:|||.::. ..
Zfish   122 VNRFR----------FSALTDADIYHLANLTGLPPKSRKGHRPSE-LQYPPP-NMLDIFQRT-GH 173

  Fly   141 NCTECFKEIYFRGELVTDC-EEIFKFHVTEMGYCFLANN-------------------LLDYDSI 185
            ...:..|...|.|:   :| .|.|....|..|.|:..|.                   :||....
Zfish   174 QLEDMLKSCNFSGQ---NCSSEDFSVVYTRYGKCYTFNGNKTSPKRVRQGGTGNGLEMMLDIQQD 235

  Fly   186 EEMPLRYSSLDNNRSLRLYMRSSVMYKYEMYVNSPEDLPFFNSLTYTISTDPTTYAFNVEEIHNH 250
            |.:|:...:  |..:|...:|        :.::|..:.|:.:.|.:.:|....|:....|:...:
Zfish   236 EYLPIWRET--NETTLEAGIR--------VQIHSQNEPPYIHQLGFGVSPGFQTFVSCQEQRLTY 290

  Fly   251 EGVIDEPISQRKCKFPSESSIEGF-PYSFSACMSIIRSEFEMKTCDCSLFN-PKDRNESLYCGLQ 313
               :.:|..  .|:..||..|.|: .||.|||.....|....:.|:|.:.: |.|.:   .|...
Zfish   291 ---LPQPWG--NCRASSEPVIPGYDTYSVSACRLHCESTQVQRECNCRMVHMPGDAD---ICAPS 347

  Fly   314 HADCLIKEGFATRVKEYVGSSTVCLPSC----VEQQISLVGVITENGTLY------------NNN 362
            ...|:.|.  ...:::..|.|..|...|    ..:::|:|.:.:.....|            .:|
Zfish   348 KIKCVDKA--LASLQKSTGDSCPCETPCNLTRYGKELSMVKIPSRGSARYLSRKYQKSEEYIRDN 410

  Fly   363 TQITEIQIASPPTVRYERKVTQTKLDLIVGIGSVAGLFFGASLLNLLEIISYFIKKLKTMI 423
            ..|.:|...:......|:|.......|:..||...|||.|||:|.:|||:.|..:..|..|
Zfish   411 FLILDIFFEALNYETIEQKKAYDIAGLLGDIGGQMGLFIGASILTILEILDYIYEVAKNKI 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 73/329 (22%)
asic4bNP_999951.1 ASC 54..497 CDD:295594 101/451 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586661
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.