DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and Y57G11C.44

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001255829.1 Gene:Y57G11C.44 / 3565567 WormBaseID:WBGene00013333 Length:155 Species:Caenorhabditis elegans


Alignment Length:76 Identity:19/76 - (25%)
Similarity:34/76 - (44%) Gaps:8/76 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LLWIFVIGISGWSTVSILVLLKTRYETDSTTIGVSTAYSRWINTFPSIGIC------LTKSRAFN 80
            |||..::.||....|.::.:...:|.:....:.::.....  :.||||..|      |:..||..
 Worm    79 LLWTTLLIISAVLFVYLITVTVRQYFSFQKLVNLNIGMVE--SNFPSITFCNTNPYKLSAVRAIP 141

  Fly    81 EFKAMMREYFQ 91
            |.:|::..|.|
 Worm   142 ELEALLTVYSQ 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230
Y57G11C.44NP_001255829.1 ASC 60..>142 CDD:279230 15/64 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162403
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.