DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and ppk17

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster


Alignment Length:385 Identity:74/385 - (19%)
Similarity:129/385 - (33%) Gaps:108/385 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 YEYAFLN-----PNNIFTKEPTKNTSYPYNFNILDIRRKMFPTNC-----TECFKEIYFRGELVT 157
            :.|..||     |:....:||      ||...:|   .::....|     ..|:.:..| ||:..
  Fly    50 HSYYSLNETIEMPSVTICREP------PYKEEVL---TRLSGGACPHPKYATCWMKYPF-GEISL 104

  Fly   158 DCEEIFKFHVTEMGYCFL-------ANNLLDYDSIEEMPLRYSSLDNNRSLRLYMRS---SVMYK 212
            |  |.|:....:.|..|:       .||::...|:.....|..:|....|.:...::   |:|.:
  Fly   105 D--EFFENSTHDSGDTFVFYGLNEDKNNVVMNSSLHFYMGRCYTLRPKESAKRVSKAVGYSIMLE 167

  Fly   213 YEMYVNSPEDLPFFNSLTYTISTDPTTYAFNVEEIHNHEGVIDEPISQRKCKFPSESSIEG---F 274
            :.|...|..|:            |..:..::| .||:           :|..| :|.:::|   .
  Fly   168 HSMLTTSVSDV------------DTGSVGWHV-FIHD-----------KKENF-TEINMKGSGRV 207

  Fly   275 PYSFSACMSIIRSEFEMKTCDCSLFNPKDRNES---------LYCGLQ----------------- 313
            .|.|..    :..|.|:|.......|.:.|.|:         |.||.|                 
  Fly   208 EYVFVG----VNEEIEIKLQTQYFSNVQTREEACSDDENYSDLKCGEQCIWQDLADNMQCSGPWM 268

  Fly   314 HA-------DCLIKEGFATRVKEYVGSSTVCLPSCVEQ-QISLVGVITENGTLYNNNTQITEIQI 370
            |.       |.|......:..|:...:.......||:. |..:.....:|...:|.....|:|.|
  Fly   269 HEIASEPCNDSLSMRKLISDYKDVYENEDDFDCDCVQPCQSRIYTTFIQNRKAFNQPEPRTQIYI 333

  Fly   371 --ASPPTVRYERKVTQTKLDLIVGIGSVAGLFFGASLLNLLEIISY--------FIKKLK 420
              .:......|.:.:......|..:|...|...|.|:|.|:.|:.:        |||:::
  Fly   334 YYTTKLISMIEERPSYDTTQFIADVGGSLGFLLGLSVLGLIGILEHMMLFFCGGFIKRMQ 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 65/353 (18%)
ppk17NP_001285988.1 ASC 11..358 CDD:295594 64/348 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456766
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.