DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and ppk11

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001334672.1 Gene:ppk11 / 34299 FlyBaseID:FBgn0065109 Length:516 Species:Drosophila melanogaster


Alignment Length:472 Identity:96/472 - (20%)
Similarity:164/472 - (34%) Gaps:155/472 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SVMNFRGFIRSFVENKGLLWIFVIGISGWSTVSILVLLKTRYETDSTTIGVSTAYSRWINT---- 65
            |:..|..|:.:....: :||        |..:...|||.......|.::...|...|:|:|    
  Fly   101 SIHGFHIFVGAKTWQR-ILW--------WLLICNAVLLSFTLVIMSLSMSKETPTIRFIDTMMKP 156

  Fly    66 -----FPSIGIC-------LTKSRAFNEFKAMMREYFQEDFAFSF----------TRMIYEYAFL 108
                 ||::.||       :..|:..|:..|...|.. ||.|...          .||:.....|
  Fly   157 TAEVPFPAVTICGFNTKEWMNSSQIVNQRNASWLELL-EDLALPICPQIKICQWDNRMVNCLDQL 220

  Fly   109 NPNNIFTKEPTKNTSYPYNFNILDIRRKMFPTNCTECFKEIYFRGELVTDCEEIFKFHVTEMGYC 173
            .|  |:|.:.....|:.||                                :::|..:   :|..
  Fly   221 QP--IWTLDQRLCCSFNYN--------------------------------KQLFSSY---LGVS 248

  Fly   174 FLANNLLDYDSIEEMPLRYSSLDNNRSLRLYMRSSVMYKYEMYVNSPEDLPFFNSLTYTISTDPT 238
            |:   |...|.|                   ::||....:|:.::...::|  |..|      |.
  Fly   249 FV---LRSNDEI-------------------LQSSKSAGFEVLIHESHEIP--NGAT------PR 283

  Fly   239 TYAFNVEEIH------------NHEGVIDEPISQRKCKFPSESS-IEGFPYSFSACMSIIRSEFE 290
            .:.....:.|            |.:|:   .:.:|.|.|.:|.. |....|:...|::..|:|..
  Fly   284 VFVPGESDAHIMLRPYINRFTKNLKGL---SLQKRGCYFSTERRLILSDVYNQINCLAECRTESI 345

  Fly   291 MKTCDCSLFNPKDRNES--LYCGLQHADCLI----KEGFATRVKEYVGSSTVCLPSC------VE 343
            :|:|.|  ..||...|.  |.|.|:...|:|    .|..:...|     :..|||.|      .:
  Fly   346 LKSCGC--IPPKSPIEKSWLICDLKQMQCVIDFDHDEIISGEQK-----NCDCLPPCEFNRYEFQ 403

  Fly   344 QQISLV-GVITENGTLYNNNTQIT--EIQIASPPTVRYERKVT--------QTKLDLIVGIGSVA 397
            ..|..: |:|  |.::.|.:.|.|  |:::    .|.|:..:.        :..|..|...|.:.
  Fly   404 SDIRFIKGMI--NNSIVNTSNQETTNEVRV----RVYYDSAIAEELLLDVYENWLTFIGTFGGIT 462

  Fly   398 GLFFGASLLNLLEIISY 414
            |||.|.|.:::.|:|.:
  Fly   463 GLFMGCSFVSVFELIFF 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 65/328 (20%)
ppk11NP_001334672.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456771
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.