DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and ppk22

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_733051.2 Gene:ppk22 / 318593 FlyBaseID:FBgn0051105 Length:561 Species:Drosophila melanogaster


Alignment Length:520 Identity:112/520 - (21%)
Similarity:176/520 - (33%) Gaps:179/520 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LLWIFVIGISGWSTVSILVLLKTRYETDSTTIGVSTAYSRWIN-----------TFPSIGIC--- 72
            |:|:.|   ...:|||::|:|...:|.       ..|.|...|           .||::.||   
  Fly    67 LIWLLV---HMATTVSLIVVLSLTWEQ-------FVAQSFVTNLKDPLFPVENVPFPAVSICPNN 121

  Fly    73 LTKSRAFNEFKAMMR---------EYFQEDFAFSFTRMIYEYA--------FLNPNNIFTKEPTK 120
            ....:|..::...:|         |||.|  ...|.|..|.:.        |:..........|.
  Fly   122 RISRQAVIQYAEELRLNSPVIRPVEYFLE--RLRFFREFYTHVGVVVDTDDFITFQTFLDVFGTW 184

  Fly   121 NTSYPYNFNILDIRRKM---------FPTNCT------ECFKEIYFRGELVT--DC------EEI 162
            |     |....|.||.|         |...||      .||.:..|:..|..  .|      .::
  Fly   185 N-----NETFFDTRRIMKMLTPRCQGFVLKCTVANVEVPCFSKDAFQDSLTMYGPCCTFNMENKL 244

  Fly   163 FKFH---------------------------VTEMGYCFLANNLLDYDSIEEMPLRYSSLDNNRS 200
            .|.|                           :...||..:.:|..:|.|:      ||       
  Fly   245 KKRHFKNRLASSELGLKVVLNDSHVDYFAPILNTNGYIVMIHNAENYASV------YS------- 296

  Fly   201 LRLYMRSSVMYKYEMYVNSPEDLPFFNSLTYTISTDPTTYAFNVEEIHNHEGVIDEPISQRKCKF 265
                  |:|:   ||:....|| .:.......:.||.:..:|:             |.| |:|.|
  Fly   297 ------SNVL---EMFPGQGED-SYIAVCARVVDTDDSLKSFS-------------PFS-RRCYF 337

  Fly   266 PSES---------SIEGFPYSFSACMSIIRSEFEMKTCDCSLFN-PKDRNESL----YCGLQHAD 316
            ..|:         :.....|:|..|::..|....:..|.|..|. |....|:|    ||.|.|..
  Fly   338 EYEAQNPIHEQLMNTYSLSYTFPNCITRCRIRSIIALCRCLPFQMPLQLVENLDGVVYCTLGHVS 402

  Fly   317 CL---------------IKEGFATRVKEYVGSSTVCLPSC--VEQQISLVGVITEN--GTL---Y 359
            ||               |..|....::|.: ....|||||  |:.::|:..:..:|  .||   .
  Fly   403 CLNQYIFKWRNILTERHIVNGLEREIEEAL-YCPQCLPSCRDVQYEVSMSALPIDNYLATLKLDE 466

  Fly   360 NNNTQI-TEIQI-----ASPPTVRYERKVTQTKLDLIVGIGSVAGLFFGASLLNLLEIISYFIKK 418
            ||.|:. |:|.:     ..|....|.|.:..|..::...||::..:|.|.|::.:.||: :|:.|
  Fly   467 NNETEFGTDISVLRVYFGDPHAQYYIRLLNNTWFEVFSTIGNIMSIFVGFSMVAIFEIL-FFVTK 530

  Fly   419  418
              Fly   531  530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 82/383 (21%)
ppk22NP_733051.2 ASC 46..527 CDD:279230 110/515 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456691
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.