DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and Scnn1g

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_058742.2 Gene:Scnn1g / 24768 RGDID:3641 Length:650 Species:Rattus norvegicus


Alignment Length:372 Identity:75/372 - (20%)
Similarity:130/372 - (34%) Gaps:102/372 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IYEYAFLNPNNIFTKEPTK---NTSYPYNFNILDIRRKMFPTNCTECFKEIYFRGELVTDCEEIF 163
            |.|:..|:..||..:.|.:   |.||                :..|.....:|.| :..|.....
  Rat   227 IQEWYKLHYMNIMAQVPLEKKINMSY----------------SAKELLVTCFFDG-MSCDARNFT 274

  Fly   164 KFHVTEMGYCFLANNLLDYDSIEEMPLRYSSLDNNRSLRLYMRSSVMYKYEMYVNSPEDLPFFNS 228
            .||....|.|:..||.      |...:..:|:..         |....:..:|:|..|..||..|
  Rat   275 LFHHPMYGNCYTFNNK------ENATILSTSMGG---------SEYGLQVILYINEDEYNPFLVS 324

  Fly   229 LT--YTISTDPTTYAFNVEEI--------------HNHEGV-IDEPISQRKCKFPSE----SSIE 272
            .|  ..:......|.| :|::              |..|.. :.||.||  |.....    ::|.
  Rat   325 STGAKVLIHQQNEYPF-IEDVGMEIETAMSTSIGMHLTESFKLSEPYSQ--CTEDGSDVPVTNIY 386

  Fly   273 GFPYSFSACMSIIRSEFEMKTCDCSLFNPKDRNESLYCGL-QHADCL-----IKEGFATRVKEYV 331
            ...||...|:........::.|.|:.::......:.||.. ||.:.:     :.:.|   |:|.:
  Rat   387 NAAYSLQICLYSCFQTKMVEKCGCAQYSQPLPPAANYCNYQQHPNWMYCYYQLYQAF---VREEL 448

  Fly   332 GSSTVCLPSCVEQQIS----------------LVGVIT-ENGTLYN---NNTQITEIQIASPPTV 376
            |..:||..||..::.:                |:.|:| :.....|   |.|.:.::.|.     
  Rat   449 GCQSVCKQSCSFKEWTLTTSLAQWPSEASEKWLLNVLTWDQSQQINKKLNKTDLAKLLIF----- 508

  Fly   377 RY----ERKVTQTKLD----LIVGIGSVAGLFFGASLLNLLEIISYF 415
             |    :|.:.::..:    |:...|...||:...|::.::|||..|
  Rat   509 -YKDLNQRSIMESPANSIEMLLSNFGGQLGLWMSCSVVCVIEIIEVF 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 67/346 (19%)
Scnn1gNP_058742.2 ENaC 24..631 CDD:273304 75/372 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 577..628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345688
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.