DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and Asic4

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_036020902.1 Gene:Asic4 / 241118 MGIID:2652846 Length:586 Species:Mus musculus


Alignment Length:486 Identity:94/486 - (19%)
Similarity:168/486 - (34%) Gaps:148/486 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 WSTVSILVLLKTRYETDSTTIGVST---------AYSRWINTFPSIGICLTKSRAFNEFKAMMRE 88
            |:...:..|....|:..|...|..|         |....:..||::.:|     ..|.|:     
Mouse    70 WALALLTSLAAFLYQAASLARGYLTRPHLVAMDPAAPAPVAGFPAVTLC-----NINRFR----- 124

  Fly    89 YFQEDFAFSFTRMIYEYAFLNPNNIF-----TKEPTKNTS--------YPYNFNILDIRRKMFPT 140
                            ::.|:..:||     |..|.|:..        || ..:::||..:. ..
Mouse   125 ----------------HSALSDADIFHLANLTGLPPKDRDGHRAAGLRYP-EPDMVDILNRT-GH 171

  Fly   141 NCTECFKEIYFRGELVTDCE-EIFKFHVTEMGYCFLANNLLDYDSIEEMPLRYSSLDNNRSLRL- 203
            ...:..|...|.|.   .|. ..|....|..|.|:..|    .|....:|.|...:.:...:.| 
Mouse   172 QLADMLKSCNFSGH---HCSASNFSVVYTRYGKCYTFN----ADPQSSLPSRAGGMGSGLEIMLD 229

  Fly   204 -----YM---RSSVMYKYE----MYVNSPEDLPFFNSLTYTISTDPTTYAFNVEEIHNHEGVIDE 256
                 |:   |.:....:|    :.::|.|:.|:.:.|.:.:|....|:....|:...:   :.:
Mouse   230 IQQEEYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQLGFGVSPGFQTFVSCQEQRLTY---LPQ 291

  Fly   257 PISQRKCKFPS---ESSIEGF-PYSFSACMSIIRSEFEMKTCDCSLFN-PKDRNESLYCGL---- 312
            |..  .|:..|   |..::|: .||.|||......|..::.|.|.:.: |....:.::...    
Mouse   292 PWG--NCRAESELREPELQGYSAYSVSACRLRCEKEAVLQRCHCRMVHMPGGHLQPVFGATLLSS 354

  Fly   313 ---QHADCLIKEGFATRVKE------------YVGSSTVCLPS----CVEQQISLVGVITE---- 354
               :...|:  ....||:..            ::|:.|:|.|:    |.:..:..:|..:|    
Mouse   355 RTSRRQRCM--RTTCTRIYTHERVLMCMSGYLHMGNETICPPNIYIECADHTLDSLGGGSEGPCF 417

  Fly   355 -----NGTLYNNNTQITEIQIASPPTVRY-ERKVTQTK---------LD---------------- 388
                 |.|.|..  :|:.::|.:..:.|| .||..:.:         ||                
Mouse   418 CPTPCNLTRYGK--EISMVKIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTSEAMEQQAA 480

  Fly   389 -----LIVGIGSVAGLFFGASLLNLLEIISY 414
                 |:..:|...|||.|||:|.||||:.|
Mouse   481 YGLSALLGDLGGQMGLFIGASILTLLEILDY 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 76/382 (20%)
Asic4XP_036020902.1 ASC 40..535 CDD:413546 94/486 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842264
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.