DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and Scnn1g

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_035456.1 Gene:Scnn1g / 20278 MGIID:104695 Length:655 Species:Mus musculus


Alignment Length:372 Identity:75/372 - (20%)
Similarity:130/372 - (34%) Gaps:102/372 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IYEYAFLNPNNIFTKEPTK---NTSYPYNFNILDIRRKMFPTNCTECFKEIYFRGELVTDCEEIF 163
            |.|:..|:..||..:.|.:   |.||                :..|.....:|.| :..|.....
Mouse   232 IQEWYKLHYMNIMAQVPLEKKINMSY----------------SAEELLVTCFFDG-MSCDARNFT 279

  Fly   164 KFHVTEMGYCFLANNLLDYDSIEEMPLRYSSLDNNRSLRLYMRSSVMYKYEMYVNSPEDLPFFNS 228
            .||....|.|:..||.      |...:..:|:..         |....:..:|:|..|..||..|
Mouse   280 LFHHPMYGNCYTFNNR------ENATILSTSMGG---------SEYGLQVILYINEDEYNPFLVS 329

  Fly   229 LT--YTISTDPTTYAFNVEEI--------------HNHEGV-IDEPISQRKCKFPSE----SSIE 272
            .|  ..:......|.| :|::              |..|.. :.||.||  |.....    ::|.
Mouse   330 STGAKVLVHQQNEYPF-IEDVGTEIETAMSTSIGMHLTESFKLSEPYSQ--CTEDGSDVPVTNIY 391

  Fly   273 GFPYSFSACMSIIRSEFEMKTCDCSLFNPKDRNESLYCGL-QHADCL-----IKEGFATRVKEYV 331
            ...||...|:........::.|.|:.::......:.||.. ||.:.:     :.:.|   |:|.:
Mouse   392 NAAYSLQICLYSCFQTKMVEKCGCAQYSQPLPPAANYCNYQQHPNWMYCYYQLYQAF---VREEL 453

  Fly   332 GSSTVCLPSCVEQQIS----------------LVGVIT-ENGTLYN---NNTQITEIQIASPPTV 376
            |..:||..||..::.:                |:.|:| :.....|   |.|.:.::.|.     
Mouse   454 GCQSVCKQSCSFKEWTLTTSLAQWPSEASEKWLLNVLTWDQSQQINKKLNKTDLAKLLIF----- 513

  Fly   377 RY----ERKVTQTKLD----LIVGIGSVAGLFFGASLLNLLEIISYF 415
             |    :|.:.::..:    |:...|...||:...|::.::|||..|
Mouse   514 -YKDLNQRSIMESPANSIEMLLSNFGGQLGLWMSCSVVCVIEIIEVF 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 67/346 (19%)
Scnn1gNP_035456.1 ENaC 24..636 CDD:273304 75/372 (20%)
deg-1 32..557 CDD:273309 73/368 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 582..636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842258
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.