DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and asic-1

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_491214.3 Gene:asic-1 / 191422 WormBaseID:WBGene00022815 Length:823 Species:Caenorhabditis elegans


Alignment Length:388 Identity:74/388 - (19%)
Similarity:138/388 - (35%) Gaps:98/388 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 QEDFAFSFTRM---IYEYAFLNPNNIFTKEP-TKNTSYPYNFNILDIRRKMFPTNCTECFKEIYF 151
            :.|.|:.:|.:   |...|....|.||..:. |:...:..::|..|     |...|:       |
 Worm   444 ERDKAYGYTGVKDRIALRAKAMENMIFAVDALTEEEKWKISYNKSD-----FIMKCS-------F 496

  Fly   152 RGELVTDCEEIFKFHVTEMGYCF-----LANNLLDYDSIEEMPLRYSSLDNNRS-----LRL--- 203
            .|.......:..::.....|.||     |.||                 .|.||     |||   
 Worm   497 NGRECNVKHDFVEYLDPTYGACFTYGQKLGNN-----------------TNERSGPAYGLRLEVF 544

  Fly   204 -----YMRSSVMYKYEMYVNSPEDLPFFNSLTYTISTDPTTY--AFNVEEIHNHEGVIDEPISQR 261
                 |:.::......:.|::.::.||.::|.::.   ||.:  :|.::    .:.::..|....
 Worm   545 VNVTEYLPTTEAAGVRLTVHATDEQPFPDTLGFSA---PTGFVSSFGIK----LKSMVRLPAPYG 602

  Fly   262 KCKFPSESSIEGFPYSFSA-----CMSIIRSEFEMKTCDCSLFNPK--DRNESLYCGLQ---HAD 316
            .|  ..|...|.|.|:..|     |......:...|||.|.  :|:  ...||..|.:.   ..:
 Worm   603 DC--VREGKTEDFIYTQKAYNTEGCQRSCIQKHLSKTCGCG--DPRFPPYRESKNCPVDDPYKRE 663

  Fly   317 CLIKE-GFATRVKEYVGSSTVCLPSCVEQQISLVGVITENGTLYNNNTQITEIQIASPPTVRYER 380
            |:..| ..|||..:.:|.|  |...| .|.:..|............:.....:.:|:...:.|:|
 Worm   664 CIKNEMHVATRDSKKLGCS--CKQPC-NQDVYSVSYSASRWPAIAGDLSGCPLGMAAHHCLNYKR 725

  Fly   381 K----------------VTQTKL----DLIVGIGSVAGLFFGASLLNLLEIISYFIKKLKTMI 423
            :                :.:::.    :|:...|...||:.|.|::.:.|:..:|.:...::|
 Worm   726 EQGSMIEVYFEQLNYESLLESEAYGWSNLLSDFGGQLGLWMGVSVITIGEVACFFFEVFISLI 788

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 63/342 (18%)
asic-1NP_491214.3 deg-1 16..779 CDD:273309 72/377 (19%)
ASC 17..>104 CDD:279230
ASC <469..788 CDD:295594 67/361 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.