DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and del-5

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_509838.2 Gene:del-5 / 186631 WormBaseID:WBGene00010334 Length:526 Species:Caenorhabditis elegans


Alignment Length:290 Identity:53/290 - (18%)
Similarity:104/290 - (35%) Gaps:106/290 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 CTECFKEIYFRGELVTDCEEIFKFHVTEMGYCFLANNLLDYDSIEEMPLRYSSLDNNRSLRLYMR 206
            |.|..||    .:.:| |:|:       ..||              :.:|:|:   ...:|| .:
 Worm   143 CNEILKE----NKQMT-CKEV-------DAYC--------------VSIRFST---KTKIRL-KK 177

  Fly   207 SSVMYKYEMYVNSPEDLPFFNSLTYTISTDPTTYAFNVEEIHNHEGV------IDE--------P 257
            ..:.:|:    .:.||:.:       :|:.|          |.|..:      ||.        .
 Worm   178 KGLYFKH----GTEEDVHY-------LSSKP----------HTHHMIRLKLIQIDRLNLGRAPCT 221

  Fly   258 ISQRKCKFPSESSIEGFPYSFSACMSIIRSEFEMKTCDCSLFNPKDRNESLYCGLQHADCLIKEG 322
            .:.|:..:..:.||..:.||.:.|.:|   .||:                               
 Worm   222 TNWREITWIEKDSIPDYRYSLNMCENI---RFEL------------------------------- 252

  Fly   323 FATRVKEYVGSSTVCLPSCVEQQISLVGVITENGTLYNNNTQITEIQIASPPTVRYERKVTQTKL 387
              ||..||:.....|.|||.|.:..    ::::...:::::.:....:....|:..|.:.| |.:
 Worm   253 --TRKVEYLQYDFPCYPSCSEIKYQ----VSKSKLRHSSDSVVITFSVLPTITLMQETRKT-TLI 310

  Fly   388 DLIVGIGSVAGLFFGASLLNLLEIISYFIK 417
            |::..:|..:.||.|.|.:.|:|:..:..|
 Worm   311 DILCYLGGASSLFMGCSCVTLMEMFVFLFK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 52/286 (18%)
del-5NP_509838.2 ASC 66..337 CDD:295594 52/285 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.